Recombinant Human SUCLG2 protein (ab152913)

Overview

  • Product name
    Recombinant Human SUCLG2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNS GLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDI SRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEG IKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGET PEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIG LDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKL LTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNV QEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK
    • Amino acids
      1 to 384
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 6.2.1.4
    • G BETA
    • GBETA
    • GTP specific succinyl-CoA synthetase beta subunit
    • GTP specific succinyl-CoA synthetase subunit beta
    • GTP-specific succinyl-CoA synthetase subunit beta
    • mitochondrial
    • SCS betaG
    • SCS-betaG
    • SUCB2_HUMAN
    • Succinate CoA ligase GDP forming beta subunit
    • Succinate-Coenzyme A ligase, GDP-forming, beta subunit
    • Succinyl CoA ligase GDP forming beta chain mitochondrial
    • Succinyl CoA synthetase betaG chain
    • Succinyl-CoA ligase [GDP-forming] subunit beta
    • Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial
    • Succinyl-CoA synthetase beta-G chain
    • SUCLG2
    see all
  • Function
    Catalyzes the GTP-dependent ligation of succinate and CoA to form succinyl-CoA.
  • Tissue specificity
    Mainly expressed in liver, kidney, heart, spleen and skeletal muscle. Also found in intestine and colon, and in low amounts in lung, brain, prostate, testis and ovary.
  • Pathway
    Carbohydrate metabolism; tricarboxylic acid cycle.
  • Sequence similarities
    Belongs to the succinate/malate CoA ligase beta subunit family.
    Contains 1 ATP-grasp domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab152913 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up