Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y2Z0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMHRVGQAGLQLLTSSDPPALDSQSAGITGA DANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQ KNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIE IKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGE IKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTN WSDVGKRKVEINPPDDMEWKKY
    • Molecular weight31 kDa including tags
    • Amino acids115 to 365
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab103785 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Protein 40 6 3
    • Protein 40-6-3
    • Protein SGT1 homolog
    • Putative 40 6 3 protein
    • Sgt1
    • SGT1 suppressor of G2 allele of SKP1
    • SGT1_HUMAN
    • SGT1B protein
    • sugt1
    • Suppressor of G2 allele of SKP1 homolog
    • Suppressor of G2 allele of SKP1 S. cerevisiae homolog of
    see all
  • FunctionMay play a role in ubiquitination and subsequent proteasomal degradation of target proteins.
  • Sequence similaritiesBelongs to the SGT1 family.
    Contains 1 CS domain.
    Contains 1 SGS domain.
    Contains 3 TPR repeats.
  • DomainThe CS domain mediates interaction with HSP90.
  • Post-translational
    modifications
    Phosphorylated at Ser-281 and Ser-331, dephosphorylation promotes nuclear translocation, most likely due to disruption of the SUGT1-HSP90 complex.
  • Cellular localizationCytoplasm. Nucleus. Translocates to the nucleus upon heat shock, requiring S100A6.
  • Information by UniProt

Recombinant Human SUGT1 protein images

  • 15% SDS-PAGE analysis of 3µg ab103785.

References for Recombinant Human SUGT1 protein (ab103785)

ab103785 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"