Recombinant Human SULT1A2 protein (ab109961)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP50226
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMELIQDISRPPLEYVKGVPLIKYFAEALGP LQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVP FLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVAR NAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWW ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFK EMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY AEKMAGCSLSFRSEL
    • Molecular weight36 kDa including tags
    • Amino acids1 to 295
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab109961 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Aryl sulfotransferase 2
    • Arylamine sulfotransferase
    • HAST4
    • MGC142287
    • MGC142289
    • P PST
    • P-PST 2
    • Phenol preferring phenol sulfotransferase 2
    • Phenol sulfotransferase 2
    • Phenol-sulfating phenol sulfotransferase 2
    • Phenolic metabolizing (P) form of PST
    • ST1A2
    • ST1A2_HUMAN
    • STP2
    • Sulfotransferase 1A2
    • Sulfotransferase family cytosolic 1A phenol preferring member 2
    • SULT1A2
    • Thermostable phenol sulfotransferase
    • TSPST2
    see all
  • FunctionCatalyzes the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Is also responsible for the sulfation and activation of minoxidil. Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
  • Sequence similaritiesBelongs to the sulfotransferase 1 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human SULT1A2 protein images

  • 15% SDS-PAGE analysis of 3µg ab109961.

References for Recombinant Human SULT1A2 protein (ab109961)

ab109961 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"