Recombinant Human SULT1A2 protein (ab173058)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSG TTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTP APRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYP HPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENP KREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDH SISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 295
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Sequence for the tag: MGSSHHHHHHSSGLVPRGSH

Specifications

Our Abpromise guarantee covers the use of ab173058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    The purity of ab173058 is geater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.58% Sodium chloride

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names
    • Aryl sulfotransferase 2
    • Arylamine sulfotransferase
    • HAST4
    • MGC142287
    • MGC142289
    • P PST
    • P-PST 2
    • Phenol preferring phenol sulfotransferase 2
    • Phenol sulfotransferase 2
    • Phenol-sulfating phenol sulfotransferase 2
    • Phenolic metabolizing (P) form of PST
    • ST1A2
    • ST1A2_HUMAN
    • STP2
    • Sulfotransferase 1A2
    • Sulfotransferase family cytosolic 1A phenol preferring member 2
    • SULT1A2
    • Thermostable phenol sulfotransferase
    • TSPST2
    see all
  • Function
    Catalyzes the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Is also responsible for the sulfation and activation of minoxidil. Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab173058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up