Recombinant Human SULT1C2 protein (ab102759)

Overview

  • Product name
    Recombinant Human SULT1C2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMALTSDLGKQIKLKEVEGTLLQPATVDNWS QIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRH PFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVA RNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGW WEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSF EKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEI YRRKMEGTSINFCMEL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 296
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • humSULTC2
    • ST1C1
    • ST1C2
    • ST1C2_HUMAN
    • Sulfotransferase 1C1
    • Sulfotransferase 1C2
    • Sulfotransferase family cytosolic 1C member 1
    • Sulfotransferase family cytosolic 1C member 2
    • SULT1C#1
    • SULT1C1
    • SULT1C2
    see all
  • Function
    Catalyzes the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hyroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).
  • Tissue specificity
    Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human SULT1C2 protein images

  • 15% SDS-PAGE showing ab102759 at approximately 37.0kDa (3µg).

References for Recombinant Human SULT1C2 protein (ab102759)

ab102759 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up