Recombinant Human SULT2A1 protein (ab108128)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ06520
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSDDFLWFEGIAFPTMGFRSETLRKVRDEF VIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVES EIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSG YFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFL LLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSN YSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRE LFPWE
    • Molecular weight36 kDa including tags
    • Amino acids1 to 285
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab108128 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Alcohol/hydroxysteroid sulfotransferase
    • Bile salt sulfotranasferase 2A1
    • Bile salt sulfotransferase
    • Dehydroepiandrosterone sulfotransferase
    • DHEA ST
    • DHEA sulfotranasferase
    • DHEA-ST
    • DHEAS
    • EC 2.8.2.14
    • Hst
    • hSTa
    • Hydroxysteroid sulfotransferase
    • ST2
    • ST2A1
    • ST2A1_HUMAN
    • ST2A3
    • STD
    • sulfotranasferase, dehydroepiandrosterone-preferring
    • Sulfotransferase 2A1
    • Sulfotransferase family 2A, dehydroepiandrosterone-preferring, member 1
    • Sulfotransferase family cytosolic 2A dehydroepiandrosterone (DHEA) preferring member 1
    • Sult2a1
    see all
  • FunctionCatalyzes the sulfation of steroids and bile acids in the liver and adrenal glands.
  • Tissue specificityLiver, adrenal and at lower level in the kidney. Is present in human fetus in higher level in the adrenal than the liver and the kidney.
  • Sequence similaritiesBelongs to the sulfotransferase 1 family.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human SULT2A1 protein images

  • 15% SDS-PAGE analysis of 3µg ab108128.

References for Recombinant Human SULT2A1 protein (ab108128)

ab108128 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"