Recombinant human Sumo 1 protein (ab157010)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKES YCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHST V
    • Molecular weight
      11 kDa
    • Amino acids
      1 to 101

Specifications

Our Abpromise guarantee covers the use of ab157010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    ab157010 activity was confirmed by its inhibition of SENP1 deSUMOylation of SUMO1-AMC. Typical assay set-up: substrate concentration: 0.1-2.0µM. Enzyme concentration: 0.1-1µM. Inhibitor concentration: 0.1-2.0µM. Release of AMC fluorescence by DUB enzymes can be monitored spectrophotometrically using 380nm excitation and 460nm emission wavelengths. Concentration determination: Sumo 1 aldehyde sample concentration determined by measurement of absorbance at 280nm by spectrophotometry, and comparison with a Sumo 1 calibration curve produced by serial dilution (2.0-0.125mg/mL).
  • Applications

    Functional Studies

    HPLC

  • Form
    Liquid
  • Additional notes
    ab157010 can be used for stabilisation of Sumo protein conjugates in cell lysates and tissue extracts; determination of inhibition kinetics for specific deSumoylating enzymes; co-crystallisation with specific deSUMOylating enzymes for structural studies; as a probe for investigating enzyme:substrate interactions; in conjunction with Sumo 2 aldehyde to probe the Sumo paralogue preference of SENP enzymes
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C. Do Not Freeze.

    Constituent: 0.55% Hydrochloric acid

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • DAP1
    • GAP modifying protein 1
    • GAP-modifying protein 1
    • GMP 1
    • GMP1
    • OFC10
    • PIC 1
    • PIC1
    • SENP2
    • Sentrin
    • Sentrin 1
    • Small ubiquitin related modifier 1
    • Small ubiquitin-like modifier 1
    • Small ubiquitin-related modifier 1
    • SMT3
    • SMT3 homolog 3
    • SMT3 suppressor of mif two 3 homolog 1
    • SMT3, yeast, homolog 3
    • Smt3C
    • SMT3H3
    • SUMO-1
    • SUMO1
    • SUMO1_HUMAN
    • Ubiquitin homology domain protein PIC1
    • Ubiquitin Like 1
    • Ubiquitin like protein SMT3C
    • Ubiquitin like protein UBL1
    • Ubiquitin-homology domain protein PIC1
    • Ubiquitin-like protein SMT3C
    • Ubiquitin-like protein UBL1
    • UBL 1
    • UBL1
    see all
  • Function
    Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. May also regulate a network of genes involved in palate development.
  • Involvement in disease
    Defects in SUMO1 are the cause of non-syndromic orofacial cleft type 10 (OFC10) [MIM:613705]; also called non-syndromic cleft lip with or without cleft palate 10. OFC10 is a birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum. Note=A chromosomal aberation involving SUMO1 is the cause of OFC10. Translocation t(2;8)(q33.1;q24.3). The breakpoint occurred in the SUMO1 gene and resulted in haploinsufficiency confirmed by protein assays.
  • Sequence similarities
    Belongs to the ubiquitin family. SUMO subfamily.
    Contains 1 ubiquitin-like domain.
  • Post-translational
    modifications
    Cleavage of precursor form by SENP1 or SENP2 is necessary for function.
    Polymeric SUMO1 chains undergo polyubiquitination by RNF4.
  • Cellular localization
    Nucleus membrane. Nucleus speckle. Cytoplasm. Recruited by BCL11A into the nuclear body.
  • Information by UniProt

Images

  • SENP Assay (typical) using ab157010. 0.5µM SENP1 Catalytic Domain (His); 2µM SUMO1-AMC; 2µM SUMO-1 aldehyde (ab157010 pink line); 20mM TRIS-Cl, pH8.0, 20mM NaCl, 5mM DTT.

References

ab157010 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up