Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC ERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY.
    • Molecular weight11 kDa

Specifications

Our Abpromise guarantee covers the use of ab73446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab73446 is is purified by proprietary chromatographic techniques. Purity is greater than 95.0% as determined by RP-HPLC and SDS-PAGE.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 1X PBS, pH 7.4

General Info

  • Alternative names
    • HSMT 3
    • HSMT3
    • MGC117191
    • Sentrin 2
    • Sentrin-2
    • Sentrin2
    • Small ubiquitin like modifier 2
    • Small ubiquitin related modifier 2
    • Small ubiquitin-related modifier 2
    • SMT 3B
    • SMT3 homolog 2
    • SMT3 suppressor of mif two 3 homolog 2
    • SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
    • SMT3, yeast, homolog 2
    • Smt3A
    • SMT3B
    • SMT3H2
    • SUMO-2
    • SUMO-3
    • SUMO2
    • SUMO2_HUMAN
    • Sumo3
    • Ubiquitin like protein SMT3B
    • Ubiquitin-like protein SMT3A
    see all
  • FunctionUbiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins.
  • Tissue specificityBroadly expressed.
  • Sequence similaritiesBelongs to the ubiquitin family. SUMO subfamily.
    Contains 1 ubiquitin-like domain.
  • Post-translational
    modifications
    Polymeric chains can be formed through Lys-11 cross-linking. Polymeric SUMO2 chains undergo 'Lys-6'-, 'Lys-11'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination by RNF4.
    Cleavage of precursor form by SENP1 or SENP2 is necessary for function.
  • Cellular localizationNucleus. Nuclear bodies.
  • Information by UniProt

References for Recombinant Human Sumo 2 protein (ab73446)

ab73446 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab73446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"