Recombinant Human Sumo 3 protein (FITC) (ab189730)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQ GLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
    • Molecular weight
      11 kDa
    • Amino acids
      1 to 92
    • Additional sequence information
      This product is for the mature full length protein from aa 1 to 92. The propeptide is not included.
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm

Associated products

Specifications

Our Abpromise guarantee covers the use of ab189730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Additional notes

    SUMO3 modified with fluorescein via primary amine coupling resulting in modification of lysine residues as well as the N-terminus. Although having a fully functional C-terminus, lysine modification may limit the ability of this reagent to propagate poly-SUMO chains. ab189730 allows for direct detection spectophotometrically with higher efficiency and sensitivity than with antibodies.

    Optimal fluorescence at pH 8.0

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.5
    Constituents: 1.19% HEPES, 0.58% Sodium chloride

General Info

  • Alternative names
    • Small ubiquitin like modifier 3
    • Small ubiquitin related modifier 3
    • Small ubiquitin-related modifier 3
    • SMT3 homolog 1
    • SMT3 suppressor of mif two 3 homolog 1
    • SMT3 suppressor of mif two 3 homolog 3
    • SMT3, yeast, homolog 1
    • SMT3A
    • Smt3B
    • SMT3H1
    • SUMO-2
    • SUMO-3
    • sumo3
    • SUMO3_HUMAN
    • Ubiquitin like protein SMT3A
    • Ubiquitin-like protein SMT3B
    see all
  • Function
    Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4.
  • Tissue specificity
    Expressed predominantly in liver.
  • Sequence similarities
    Belongs to the ubiquitin family. SUMO subfamily.
    Contains 1 ubiquitin-like domain.
  • Post-translational
    modifications
    Polymeric chains can be formed through Lys-11 cross-linking.
    Cleavage of precursor form by SENP1, SENP2 or SENP5 is necessary for function.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab189730 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up