Recombinant Human Superoxide Dismutase 3 protein (ab114298)

Overview

  • Product name
    Recombinant Human Superoxide Dismutase 3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQ PRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC
    • Molecular weight
      37 kDa including tags
    • Amino acids
      26 to 125

Specifications

Our Abpromise guarantee covers the use of ab114298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC SOD
    • EC-SOD
    • Extracellular superoxide dismutase
    • Extracellular superoxide dismutase [Cu Zn]
    • Extracellular superoxide dismutase [Cu-Zn]
    • Extracellular superoxide dismutase precursor
    • MGC20077
    • SOD 3
    • SOD3
    • SODE_HUMAN
    • Superoxide dismutase 3 extracellular
    see all
  • Function
    Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen.
  • Tissue specificity
    Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.
  • Sequence similarities
    Belongs to the Cu-Zn superoxide dismutase family.
  • Cellular localization
    Secreted > extracellular space. 99% of EC-SOD is anchored to heparan sulfate proteoglycans in the tissue interstitium, and 1% is located in the vasculature in equilibrium between the plasma and the endothelium.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE image showing ab114298 Stained with Coomassie Blue.

References

ab114298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up