Recombinant Human Superoxide Dismutase 3 protein (ab114298)

Overview

  • Product nameRecombinant Human Superoxide Dismutase 3 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP08294
    • SpeciesHuman
    • SequenceEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQ PRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC
    • Molecular weight37 kDa including tags
    • Amino acids26 to 125

Specifications

Our Abpromise guarantee covers the use of ab114298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC SOD
    • EC-SOD
    • Extracellular superoxide dismutase
    • Extracellular superoxide dismutase [Cu Zn]
    • Extracellular superoxide dismutase [Cu-Zn]
    • Extracellular superoxide dismutase precursor
    • MGC20077
    • SOD 3
    • SOD3
    • SODE_HUMAN
    • Superoxide dismutase 3 extracellular
    see all
  • FunctionProtect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen.
  • Tissue specificityExpressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.
  • Sequence similaritiesBelongs to the Cu-Zn superoxide dismutase family.
  • Cellular localizationSecreted > extracellular space. 99% of EC-SOD is anchored to heparan sulfate proteoglycans in the tissue interstitium, and 1% is located in the vasculature in equilibrium between the plasma and the endothelium.
  • Information by UniProt

Recombinant Human Superoxide Dismutase 3 protein images

  • 12.5% SDS-PAGE image showing ab114298 Stained with Coomassie Blue.

References for Recombinant Human Superoxide Dismutase 3 protein (ab114298)

ab114298 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"