Recombinant Human Superoxide Dismutase 4 protein (ab99300)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO14618
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVR KSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGS GQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLH VHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAI FRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGII ARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
    • Molecular weight31 kDa including tags
    • Amino acids1 to 274
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99300 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • CCS
    • CCS_HUMAN
    • Copper chaperone for superoxide dismutase
    • MGC138260
    • SOD 4
    • SOD4
    • Superoxide dismutase copper chaperone
    see all
  • FunctionDelivers copper to copper zinc superoxide dismutase (SOD1).
  • Tissue specificityUbiquitous.
  • Sequence similaritiesIn the C-terminal section; belongs to the Cu-Zn superoxide dismutase family.
    Contains 1 HMA domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Superoxide Dismutase 4 protein images

  • 15% SDS-PAGE showing ab299300 (3µg).

References for Recombinant Human Superoxide Dismutase 4 protein (ab99300)

ab99300 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"