Recombinant Human Survivin (mutated A128 V + E129 K) protein (ab99448)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGAPTLPPAWQPFLKDHRISTFKNWPFLEG CACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKH SSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETVKK VRRAIEQLAAMD
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 142
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab99448 is sterile filtered.
  • Form
    Lyophilised
  • Additional notes
    ENDOTOXIN: Less than 0.1 ng/µg.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute to a concentration of 0.1-1.0 mg/ml in PBS.

General Info

  • Alternative names
    • API4
    • Apoptosis inhibitor 4
    • Apoptosis inhibitor survivin
    • Apoptosis inhibitor4
    • Baculoviral IAP repeat containing 5
    • Baculoviral IAP repeat containing protein 5
    • Baculoviral IAP repeat-containing protein 5
    • BIRC 5
    • BIRC5
    • BIRC5_HUMAN
    • EPR 1
    • IAP4
    • Survivin variant 3 alpha
    • SVV
    • TIAP
    see all
  • Function
    Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May play a role in neoplasia. May counteract a default induction of apoptosis in G2/M phase. Inhibitor of caspase-3 and caspase-7. Isoform 2 and isoform 3 do not appear to play vital roles in mitosis. Isoform 3 shows a marked reduction in its anti-apoptotic effects when compared with the displayed wild-type isoform.
  • Tissue specificity
    Expressed only in fetal kidney and liver, and to lesser extent, lung and brain. Abundantly expressed in adenocarcinoma (lung, pancreas, colon, breast, and prostate) and in high-grade lymphomas. Also expressed in various renal cell carcinoma cell lines.
  • Sequence similarities
    Belongs to the IAP family.
    Contains 1 BIR repeat.
  • Developmental stage
    Expression is cell cycle-dependent and peaks at mitosis.
  • Domain
    The BIR repeat is necessary and sufficient for HBXIP binding.
  • Post-translational
    modifications
    Ubiquitination is required for centrosomal targeting.
    In vitro phosphorylation at Thr-117 by AURKB/STK12 prevents interaction with INCENP and localization to mitotic chromosomes.
  • Cellular localization
    Cytoplasm. Nucleus. Chromosome. Chromosome > centromere. Cytoplasm > cytoskeleton > spindle. Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with AURKB at mitotic chromosomes.
  • Information by UniProt

References for Recombinant Human Survivin (mutated A128 V + E129 K) protein (ab99448)

ab99448 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99448.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up