Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15022
    • SpeciesHuman
    • SequenceVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLE KGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL
    • Molecular weight37 kDa including tags
    • Amino acids640 to 739

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

    Other

  • FormLiquid
  • Additional notesBest to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • ChET 9 protein
    • CHET9
    • Chromatin precipitated E2F target 9 protein
    • JJAZ1
    • Joined to JAZF1 protein
    • KIAA0160
    • Polycomb protein SUZ12
    • Suppressor of zeste 12 homolog
    • Suppressor of zeste 12 protein homolog
    • SUZ12
    • SUZ12 polycomb repressive complex 2 subunit
    • SUZ12_HUMAN
    see all
  • FunctionPolycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.
  • Tissue specificityOverexpressed in breast and colon cancer.
  • Involvement in diseaseNote=A chromosomal aberration involving SUZ12 may be a cause of endometrial stromal tumors. Translocation t(7;17)(p15;q21) with JAZF1. The translocation generates the JAZF1-SUZ12 oncogene consisting of the N-terminus part of JAZF1 and the C-terminus part of SUZ12. It is frequently found in all cases of endometrial stromal tumors, except in endometrial stromal sarcomas, where it is rarer.
  • Sequence similaritiesBelongs to the VEFS (VRN2-EMF2-FIS2-SU(Z)12) family.
    Contains 1 C2H2-type zinc finger.
  • Developmental stageExpressed at low levels in quiescent cells. Expression rises at the G1/S phase transition.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SUZ12 protein images

  • 12.5% SDS-PAGE analysis of ab112401. Stained with Coomassie Blue

References for Recombinant Human SUZ12 protein (ab112401)

ab112401 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"