Recombinant Human SWAP70 protein (ab161526)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYL KLQEALEDERQARQDEETVRKLQA
    • Amino acids
      378 to 451
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0640
    • 70kDa
    • AV235546
    • FLJ39540
    • HSPC321
    • SWA 70 protein
    • SWAP 70
    • SWAP switching B-cell complex 70kDa subunit
    • SWAP-70
    • SWAP70
    • Switch associated protein 70
    • Switch-associated protein 70
    • SWP70_HUMAN
    see all
  • Function
    Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. It also mediates signaling of membrane ruffling. Regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion.
  • Tissue specificity
    Expressed only in mature B-cells including those associated with mucosa-associated tissue and bronchus-associated tissue (PubMed:10681448). Widely expressed. Abundant in spleen, and fairly abundant in kidney, lung and liver. Also found in monocytes and macrophages (PubMed:12925760).
  • Sequence similarities
    Contains 1 PH domain.
  • Domain
    The PH domain is essential for phosphatidylinositol 3,4,5-trisphosphate binding.
  • Post-translational
    modifications
    Tyrosine-phosphorylated.
  • Cellular localization
    Cytoplasm. Cell membrane. Nucleus. Cell projection > lamellipodium. In resting B-cells it is localized mainly in the cytoplasm and upon cell activation it is recruited to the plasma membrane and then translocates to the nucleus. In activated, class-switching B-cells it is associated with membrane IgG but not IgM. Localized to loose actin filament arrays located behind actively extending lamellipodia.
  • Information by UniProt

Images

  • ab161526 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up