Recombinant Human Synaptophysin protein (ab114166)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP08247
    • SpeciesHuman
    • SequenceMLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYS GELQLNVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVG DYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAV FAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVT SGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGD AYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQ GYGPQGAPTSFSNQM
    • Molecular weight61 kDa including tags
    • Amino acids1 to 313

Specifications

Our Abpromise guarantee covers the use of ab114166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114166 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Major synaptic vesicle protein p38
    • MRX96
    • MRXSYP
    • Syn p38
    • Synaptophysin
    • Syp
    • SYPH
    • SYPH_HUMAN
    • SypI
    see all
  • FunctionPossibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity.
  • Tissue specificityCharacteristic of a type of small (30-80 nm) neurosecretory vesicles, including presynaptic vesicles, but also vesicles of various neuroendocrine cells of both neuronal and epithelial phenotype.
  • Involvement in diseaseMental retardation, X-linked, SYP-related
  • Sequence similaritiesBelongs to the synaptophysin/synaptobrevin family.
    Contains 1 MARVEL domain.
  • DomainThe calcium-binding activity is thought to be localized in the cytoplasmic tail of the protein.
  • Post-translational
    modifications
    Ubiquitinated; mediated by SIAH1 or SIAH2 and leading to its subsequent proteasomal degradation.
  • Cellular localizationCytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Cell junction, synapse, synaptosome.
  • Information by UniProt

Recombinant Human Synaptophysin protein images

  • 12.5% SDS-PAGE analysis of ab114166, stained with Coomassie Blue.

References for Recombinant Human Synaptophysin protein (ab114166)

ab114166 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"