Recombinant Human Synaptotagmin 1 protein (ab108130)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP21579
    • SpeciesHuman
    • SequenceMEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKV FLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDR FSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYV PTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKN TLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNLE HHHHHH
    • Molecular weight30 kDa including tags
    • Amino acids136 to 382
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab108130 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • DKFZp781D2042
    • FLJ42519
    • p65
    • SVP65
    • Synaptotagmin 2
    • Synaptotagmin I
    • Synaptotagmin II
    • Synaptotagmin-1
    • SYT
    • Syt1
    • SYT1_HUMAN
    • Syt2
    • SytI
    see all
  • FunctionMay have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2.
  • Sequence similaritiesBelongs to the synaptotagmin family.
    Contains 2 C2 domains.
  • DomainThe first C2 domain mediates Ca(2+)-dependent phospholipid binding.
    The second C2 domain mediates interaction with SV2A and STN2.
  • Cellular localizationCytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Cytoplasmic vesicle > secretory vesicle > chromaffin granule membrane. Cytoplasm. Synaptic vesicles and chromaffin granules.
  • Information by UniProt

Recombinant Human Synaptotagmin 1 protein images

  • 15% SDS-PAGE analysis of 3µg ab108130.

References for Recombinant Human Synaptotagmin 1 protein (ab108130)

ab108130 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"