Recombinant Human Synaptotagmin 1 protein (ab108130)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKV FLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDR FSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYV PTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKN TLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNLE HHHHHH
    • Molecular weight
      30 kDa including tags
    • Amino acids
      136 to 382
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab108130 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • DKFZp781D2042
    • FLJ42519
    • p65
    • SVP65
    • Synaptotagmin 2
    • Synaptotagmin I
    • Synaptotagmin II
    • Synaptotagmin-1
    • SYT
    • Syt1
    • SYT1_HUMAN
    • Syt2
    • SytI
    see all
  • Function
    May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2.
  • Sequence similarities
    Belongs to the synaptotagmin family.
    Contains 2 C2 domains.
  • Domain
    The first C2 domain mediates Ca(2+)-dependent phospholipid binding.
    The second C2 domain mediates interaction with SV2A and STN2.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Cytoplasmic vesicle > secretory vesicle > chromaffin granule membrane. Cytoplasm. Synaptic vesicles and chromaffin granules.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab108130.

References

ab108130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up