Recombinant Human Synaptotagmin V protein (ab91737)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFD RFSRNDAIGEVRVPMSSVDLGRPVQAWRELQAAPREEQEKLGDICFSL RYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKT TIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRV AVGAAAGGAGLRHWADMLANPRRPIAQWHSLRPPDRVRLLPAP (Amin o acid sequence (Sequence determined by 5' Sequencing))
    • Amino acids152 to 386

Specifications

Our Abpromise guarantee covers the use of ab91737 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 96 µl aqua dest.

General Info

  • Alternative names
    • Synaptotagmin 5
    • Synaptotagmin IX
    • Synaptotagmin V
    • Synaptotagmin-5
    • Syt5
    • SYT5_HUMAN
    • SytV
    see all
  • FunctionMay be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Regulates the Ca(2+)-dependent secretion of norepinephrine in PC12 cells. Required for export from the endocytic recycling compartment to the cell surface.
  • Sequence similaritiesBelongs to the synaptotagmin family.
    Contains 2 C2 domains.
  • Cellular localizationCytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Recycling endosome membrane. In mast cells, localizes to the endocytic recycling compartment.
  • Information by UniProt

Recombinant Human Synaptotagmin V protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human Synaptotagmin V protein (ab91737)

ab91737 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91737.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"