Recombinant human SynCAM protein (ab167740)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKD SRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPP RNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEE WSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQ VHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLS GPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTT TTTTTTTTTILTIITDSRAGEEGSIRAVDH
    • Molecular weight
      39 kDa including tags
    • Amino acids
      45 to 374
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its binding ability in a functional ELISA. Immobilized rhCADM1 at 2 µg/ml (100 µl/well) can bind biotinylated Human CRTAM with a linear range of 12.5 – 500 ng/ml.
  • Applications

    Functional Studies

    SDS-PAGE

    ELISA

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab167740 was lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 100 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • BL2
    • Cadm1
    • CADM1_HUMAN
    • Cell adhesion molecule 1
    • DKFZp686F1789
    • IgSF4
    • IGSF4A
    • Immunoglobulin superfamily member 4
    • MGC149785
    • MGC51880
    • NECL-2
    • NECL2
    • Nectin like 2
    • Nectin-like protein 2
    • RA175
    • SgIGSF
    • Spermatogenic immunoglobulin superfamily
    • ST17
    • sTSLC 1
    • Synaptic cell adhesion molecule
    • SynCAM
    • SynCAM1
    • TSLC-1
    • TSLC1
    • Tumor suppressor in lung cancer 1
    see all
  • Function
    Mediates homophilic cell-cell adhesion in a Ca(2+)-independent manner. Also mediates heterophilic cell-cell adhesion with CADM3 and PVRL3 in a Ca(2+)-independent manner. Acts as a tumor suppressor in non-small-cell lung cancer (NSCLC) cells. Interaction with CRTAM promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo. May contribute to the less invasive phenotypes of lepidic growth tumor cells. In mast cells, may mediate attachment to and promote communication with nerves. CADM1, together with MITF, is essential for development and survival of mast cells in vivo. May act as a synaptic cell adhesion molecule that drives synapse assembly. May be involved in neuronal migration, axon growth, pathfinding, and fasciculation on the axons of differentiating neurons. May play diverse roles in the spermatogenesis including in the adhesion of spermatocytes and spermatids to Sertoli cells and for their normal differentiation into mature spermatozoa.
  • Sequence similarities
    Belongs to the nectin family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain
    The cytoplasmic domain appears to play a critical role in proapoptosis and tumor suppressor activity in NSCLC.
  • Cellular localization
    Cell membrane. Associates with perinuclear and plasma membranes in vivo. Localized to the basolateral plasma membrane of epithelial cells in gall bladder.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab167740 and staining overnight with Coomassie Blue. In DTT-reduced SDS-PAGE, SynCAM protein migrates as 38.5kDa, 50kDa and 55-85 kDa poly peptide due to different glycosylation.

References

ab167740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up