Recombinant Human Syndecan-1 protein (ab191664)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLT AIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEAT PRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQ ADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAV VAVEPDRRNQSPVDQGATGASQGLLDRKEVLG
    • Molecular weight
      25 kDa including tags
    • Amino acids
      23 to 254
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain of Syndecan-1.

Specifications

Our Abpromise guarantee covers the use of ab191664 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 92 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    Size: 1 mg It is recommended to reconstitute the lyophilized product in 1000 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names
    • CD_antigen
    • CD138
    • CD138 antigen
    • heparan sulfate proteoglycan fibroblast growth factor receptor
    • SDC
    • Sdc1
    • SDC1_HUMAN
    • SYND1
    • Syndecan
    • Syndecan 1
    • syndecan proteoglycan 1
    • Syndecan-1
    see all
  • Function
    Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix.
  • Sequence similarities
    Belongs to the syndecan proteoglycan family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • The purity of ab191664 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue.

    DTT-reduced protein migrates as 48-60 kDa due to glycosylation.

References

ab191664 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191664.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up