Recombinant Human Syndecan 2 protein (ab114554)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTS AAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNV
    • Molecular weight
      37 kDa including tags
    • Amino acids
      32 to 130

Specifications

Our Abpromise guarantee covers the use of ab114554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD362
    • Fibroglycan
    • Heparan sulfate proteoglycan core protein
    • HSPG
    • SDC2
    • SDC2_HUMAN
    • SYND2
    • Syndecan-2
    see all
  • Function
    Cell surface proteoglycan that bears heparan sulfate.
  • Sequence similarities
    Belongs to the syndecan proteoglycan family.
  • Post-translational
    modifications
    O-glycosylated with core 1 or possibly core 8 glycans. Contains heparan sulfate.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human Syndecan 2 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114554

References for Recombinant Human Syndecan 2 protein (ab114554)

ab114554 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up