Recombinant Human Syndecan 2 protein (ab114554)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTS AAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNV
    • Molecular weight
      37 kDa including tags
    • Amino acids
      32 to 130

Specifications

Our Abpromise guarantee covers the use of ab114554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD362
    • Fibroglycan
    • Heparan sulfate proteoglycan core protein
    • HSPG
    • SDC2
    • SDC2_HUMAN
    • SYND2
    • Syndecan-2
    see all
  • Function
    Cell surface proteoglycan that bears heparan sulfate.
  • Sequence similarities
    Belongs to the syndecan proteoglycan family.
  • Post-translational
    modifications
    O-glycosylated with core 1 or possibly core 8 glycans. Contains heparan sulfate.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114554

References

ab114554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up