Recombinant Human Syndecan 4 protein (ab117191)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP31431
    • SpeciesHuman
    • SequenceMESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLD DLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRIS PVEESEDVSNKVSMSSTVQGSNIFERTE
    • Molecular weight14 kDa
    • Amino acids19 to 145

Specifications

Our Abpromise guarantee covers the use of ab117191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 85 % SDS-PAGE.
    ab117191 is purified by proprietary chromatographic techniques and is greater than 85% as determined by SDS-PAGE.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 10% Glycerol, 0.24% Tris

General Info

  • Alternative names
    • Amphiglycan
    • MGC22217
    • OTTHUMP00000031788
    • Ryudocan
    • ryudocan amphiglycan
    • Ryudocan core protein
    • SDC 4
    • Sdc4
    • SDC4_HUMAN
    • SYND 4
    • SYND4
    • syndecan 4
    • syndecan 4 (amphiglycan, ryudocan)
    • syndecan proteoglycan 4
    • Syndecan-4
    • Syndecan4
    see all
  • FunctionCell surface proteoglycan that bears heparan sulfate.
  • Tissue specificityExpressed in epithelial and fibroblastic cells.
  • Sequence similaritiesBelongs to the syndecan proteoglycan family.
  • Post-translational
    modifications
    Shedding is enhanced by a number of factors such as heparanase, thrombin or EGF. Also by stress and wound healing. PMA-mediated shedding is inhibited by TIMP3.
  • Cellular localizationMembrane. Secreted. Shedding of the ectodomain produces a soluble form.
  • Information by UniProt

References for Recombinant Human Syndecan 4 protein (ab117191)

ab117191 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"