Recombinant Human Syntaxin 2 protein (ab114555)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYV EEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFD QDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQR QLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKD IMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEET KKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 287

Specifications

Our Abpromise guarantee covers the use of ab114555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EPIM
    • Epimorphin
    • EPM
    • MGC51014
    • OTTHUMP00000238636
    • OTTHUMP00000238637
    • Stx2
    • STX2_HUMAN
    • STX2A
    • STX2B
    • STX2C
    • Syntaxin 2A
    • Syntaxin 2B
    • Syntaxin 2C
    • Syntaxin-2
    see all
  • Function
    Essential for epithelial morphogenesis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.
  • Sequence similarities
    Belongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human Syntaxin 2 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Syntaxin 2 protein (ab114555)

ab114555 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up