Recombinant Human Syntaxin 2 protein (ab114555)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYV EEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFD QDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQR QLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKD IMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEET KKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 287

Specifications

Our Abpromise guarantee covers the use of ab114555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EPIM
    • Epimorphin
    • EPM
    • MGC51014
    • OTTHUMP00000238636
    • OTTHUMP00000238637
    • Stx2
    • STX2_HUMAN
    • STX2A
    • STX2B
    • STX2C
    • Syntaxin 2A
    • Syntaxin 2B
    • Syntaxin 2C
    • Syntaxin-2
    see all
  • Function
    Essential for epithelial morphogenesis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.
  • Sequence similarities
    Belongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up