Recombinant Human Syntaxin 5A protein (ab152715)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSCRDRTQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKD LSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQ DFVRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQ RSRREQFSRAPVSALPLAPNHLGGGAVVLGAESHASKDVAIDMMDSRTSQ QLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEETIQRI DENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFL A
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 301

Specifications

Our Abpromise guarantee covers the use of ab152715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • OTTHUMP00000185028
    • SED5
    • STX5
    • STX5_HUMAN
    • STX5A
    • Syntaxin 5
    • Syntaxin 5A
    • Syntaxin-5
    • Syntaxin5
    • Syntaxin5A
    see all
  • Function
    Mediates endoplasmic reticulum to Golgi transport.
  • Sequence similarities
    Belongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization
    Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152715 stained with Coomassie Blue.

References

ab152715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up