Recombinant Human Syntaxin 6 protein (ab112390)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO43752
    • SpeciesHuman
    • SequenceMSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNEL RNNLRSIEWDLEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVR DMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRA NSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVM LEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLI LFLVL
    • Molecular weight54 kDa including tags
    • Amino acids1 to 255

Specifications

Our Abpromise guarantee covers the use of ab112390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

    Other

  • FormLiquid
  • Additional notesBest to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • LAMB2
    • LAMC1
    • Laminin B2 chain
    • Laminin-1 subunit gamma
    • Laminin-10 subunit gamma
    • Laminin-11 subunit gamma
    • STX 6
    • STX6
    • STX6_HUMAN
    • Syntaxin-6
    • Syntaxin6
    see all
  • FunctionInvolved in intracellular vesicle trafficking.
  • Sequence similaritiesBelongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationGolgi apparatus membrane.
  • Information by UniProt

Recombinant Human Syntaxin 6 protein images

  • 12.5% SDS-PAGE analysis of ab112390. Stained with Coomassie Blue.

References for Recombinant Human Syntaxin 6 protein (ab112390)

ab112390 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"