Recombinant Human Syntaxin 6 protein (ab112390)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNEL RNNLRSIEWDLEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVR DMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRA NSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVM LEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLI LFLVL
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 255

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

    Other

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • LAMB2
    • LAMC1
    • Laminin B2 chain
    • Laminin-1 subunit gamma
    • Laminin-10 subunit gamma
    • Laminin-11 subunit gamma
    • STX 6
    • STX6
    • STX6_HUMAN
    • Syntaxin-6
    • Syntaxin6
    see all
  • Function
    Involved in intracellular vesicle trafficking.
  • Sequence similarities
    Belongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab112390. Stained with Coomassie Blue.

References

ab112390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up