Recombinant Human Syntenin protein (ab101950)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO00560
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSLYPSLEDLKVDKVIQAQTAFSANPANPA ILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQG QLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLK SIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQ AFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARN GLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIK RMAPSIMKSLMDHTIPEV
    • Molecular weight35 kDa including tags
    • Amino acids1 to 298
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101950 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • MDA-9
    • MDA9
    • Melanoma differentiation-associated protein 9
    • Pro-TGF-alpha cytoplasmic domain-interacting protein 18
    • Scaffold protein Pbp1
    • SDCB1_HUMAN
    • SDCBP
    • ST1
    • SYCL
    • Syndecan binding protein (syntenin)
    • Syndecan binding protein 1
    • Syndecan-binding protein 1
    • Syntenin 1
    • Syntenin-1
    • TACIP18
    see all
  • FunctionSeems to function as an adapter protein. In adherens junctions may function to couple syndecans to cytoskeletal proteins or signaling components. Seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA). May also play a role in vesicular trafficking. Seems to be required for the targeting of TGFA to the cell surface in the early secretory pathway.
  • Tissue specificityWidely expressed. Expressed in fetal kidney, liver, lung and brain. In adult highest expression in heart and placenta.
  • Sequence similaritiesContains 2 PDZ (DHR) domains.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues.
  • Cellular localizationCell junction > focal adhesion. Cell junction > adherens junction. Cell membrane. Endoplasmic reticulum membrane. Nucleus. Melanosome. Cytoplasm > cytosol. Cytoplasm > cytoskeleton. Mainly membrane-associated. Localized to adherens junctions, focal adhesions and endoplasmic reticulum. Colocalized with actin stress fibers. Also found in the nucleus. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Recombinant Human Syntenin protein images

  • 15% SDS-PAGE analysis of 3µg ab101950.

References for Recombinant Human Syntenin protein (ab101950)

ab101950 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"