Recombinant Human Syntrophin alpha 1 protein (ab116180)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMASGRRAPRTGLLELRAGAGSGAGGER WQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEPGAGPPQL PEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTE ALFVGDAILSVNGEDLSSATHDEAVQVLKKTGKEVVLEVKYMKDVSPYFK NSTGGTSVGWDSPPASPLQRQPSSPGPTPRNFSEAKHMSLKMAYVSKRCT PNDPEPRYLEICSADGQDTLFLRAKDEASARSWATAIQAQVNTLTPRVKD ELQALLAATSTAGSQDIKQIGWLTEQLPSGGTAPTLALLTEKELLLYLSL PETREALSRPARTAPLIATRLVHSGPSKGSVPYDAELSFALRTGTRHGVD THLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHI DKGFTLWAAEPGAARAVLLRQPFEKLQMSSDDGASLLFLDFGGAEGEIQL DLHSCPKTIVFIIHSFLSAKVTRLGLLA
    • Molecular weight
      56 kDa including tags
    • Amino acids
      1 to 505
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    ab116180 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • 59 kDa dystrophin-associated protein A1 acidic component 1
    • Acidic alpha 1 syntrophin
    • Alpha 1 syntrophin
    • Alpha-1-syntrophin
    • dJ1187J4.5
    • Dystrophin associated protein A1 59kDa acidic component
    • LQT12
    • OTTHUMP00000030650
    • Pro-TGF-alpha cytoplasmic domain-interacting protein 1
    • SNT1
    • Snta1
    • SNTA1_HUMAN
    • Syntrophin 1
    • Syntrophin-1
    • TACIP1
    see all
  • Function
    Adapter protein that binds to and probably organizes the subcellular localization of a variety of membrane proteins. May link various receptors to the actin cytoskeleton and the extracellular matrix via the dystrophin glycoprotein complex. Plays an important role in synapse formation and in the organization of UTRN and acetylcholine receptors at the neuromuscular synapse. Binds to phosphatidylinositol 4,5-biphosphate.
  • Tissue specificity
    High expression in skeletal muscle and heart. Low expression in brain, pancreas, liver, kidney and lung. Not detected in placenta.
  • Involvement in disease
    Defects in SNTA1 are the cause of long QT syndrome type 12 (LQT12) [MIM:612955]. A heart disorder characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to excercise or emotional stress, and can present with a sentinel event of sudden cardiac death in infancy.
  • Sequence similarities
    Belongs to the syntrophin family.
    Contains 1 PDZ (DHR) domain.
    Contains 2 PH domains.
    Contains 1 SU (syntrophin unique) domain.
  • Domain
    The PH 1 domain mediates the oligomerization in a calcium dependent manner, and the association with the phosphatidylinositol 4,5-biphosphate.
    The PDZ domain binds to the last three or four amino acids of ion channels and receptor proteins. The association with dystrophin or related proteins probably leaves the PDZ domain available to recruit proteins to the membrane.
    The SU domain binds calmodulin in a calcium-dependent manner.
  • Post-translational
    modifications
    Phosphorylated by CaM-kinase II. Phosphorylation may inhibit the interaction with DMD.
  • Cellular localization
    Cell membrane > sarcolemma. Cell junction. Cytoplasm > cytoskeleton. In skeletal muscle, it localizes at the cytoplasmic side of the sarcolemmal membrane and at neuromuscular junctions.
  • Information by UniProt

Recombinant Human Syntrophin alpha 1 protein images

  • ab116180 (3µg) analysed on a 15% SDS-PAGE gel.

References for Recombinant Human Syntrophin alpha 1 protein (ab116180)

ab116180 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up