Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELR SPITSL
    • Amino acids
      84 to 139
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp781D015
    • KIAA0080
    • MGC10881
    • MGC17226
    • Synaptotagmin 11
    • Synaptotagmin 12
    • Synaptotagmin XI
    • Synaptotagmin-11
    • Synaptotagmin11
    • Synaptotagmin12
    • SynaptotagminXI
    • SYT 11
    • SYT 12
    • Syt XI
    • Syt11
    • SYT11_HUMAN
    • SYT12
    • SytXI
    see all
  • Function
    May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis.
  • Sequence similarities
    Belongs to the synaptotagmin family.
    Contains 2 C2 domains.
  • Post-translational
    modifications
    Ubiquitinated and targeted to the proteasome complex for degradation.
  • Cellular localization
    Membrane. Cell junction > synapse. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. In substantia nigra, observed in neuronal cell bodies and neurites. Found in the core of the Lewy bodies in the brain of sporadic Parkinson disease patients.
  • Information by UniProt

Images

  • ab161571 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up