Overview

  • Product name
    Recombinant Human SYT2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVL DYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEE VDALLGKN
    • Amino acids
      311 to 418
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Synaptotagmin 2
    • Synaptotagmin II
    • Synaptotagmin-2
    • Synaptotagmin2
    • SynaptotagminII
    • SYT 2
    • Syt II
    • Syt2
    • SYT2_HUMAN
    • SytII
    see all
  • Function
    May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone.
  • Sequence similarities
    Belongs to the synaptotagmin family.
    Contains 2 C2 domains.
  • Domain
    The first C2 domain mediates Ca(2+)-dependent phospholipid binding.
    The second C2 domain mediates interaction with Stonin 2.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Cytoplasmic vesicle > secretory vesicle > chromaffin granule membrane. Synaptic vesicles and chromaffin granules.
  • Information by UniProt

Images

  • ab165289 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165289 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up