Recombinant Human T Plastin protein (ab116732)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPG YKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRK EGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMN PNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLA LNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEA LAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSK AYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCR QFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREE RTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPY PKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQ LMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTIS SSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARV YALPEDLVEVKPKMVMTVFACLMGRGMKRV
    • Molecular weight
      95 kDa including tags
    • Amino acids
      1 to 630

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BMND18
    • Plastin 3
    • Plastin 3 (T isoform)
    • Plastin-3
    • PLS3
    • PLST_HUMAN
    • T fimbrin
    • T-plastin
    see all
  • Function
    Actin-bundling protein found in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia.
  • Tissue specificity
    Expressed in a variety of organs, including muscle, brain, uterus and esophagus.
  • Sequence similarities
    Contains 2 actin-binding domains.
    Contains 4 CH (calponin-homology) domains.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE of ab116732 stained with Coomassie Blue.

References

ab116732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up