Recombinant Human T Plastin protein (ab116732)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPG YKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRK EGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMN PNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLA LNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEA LAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSK AYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCR QFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREE RTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPY PKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQ LMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTIS SSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARV YALPEDLVEVKPKMVMTVFACLMGRGMKRV
    • Molecular weight
      95 kDa including tags
    • Amino acids
      1 to 630

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BMND18
    • Plastin 3
    • Plastin 3 (T isoform)
    • Plastin-3
    • PLS3
    • PLST_HUMAN
    • T fimbrin
    • T-plastin
    see all
  • Function
    Actin-bundling protein found in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia.
  • Tissue specificity
    Expressed in a variety of organs, including muscle, brain, uterus and esophagus.
  • Sequence similarities
    Contains 2 actin-binding domains.
    Contains 4 CH (calponin-homology) domains.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human T Plastin protein images

  • 12.5% SDS-PAGE of ab116732 stained with Coomassie Blue.

References for Recombinant Human T Plastin protein (ab116732)

ab116732 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up