Recombinant Human T Plastin protein (ab116732)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP13797
    • SpeciesHuman
    • SequenceMDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPG YKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRK EGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMN PNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLA LNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEA LAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSK AYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCR QFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREE RTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPY PKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQ LMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTIS SSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARV YALPEDLVEVKPKMVMTVFACLMGRGMKRV
    • Molecular weight95 kDa including tags
    • Amino acids1 to 630

Specifications

Our Abpromise guarantee covers the use of ab116732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BMND18
    • Plastin 3
    • Plastin 3 (T isoform)
    • Plastin-3
    • PLS3
    • PLST_HUMAN
    • T fimbrin
    • T-plastin
    see all
  • FunctionActin-bundling protein found in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia.
  • Tissue specificityExpressed in a variety of organs, including muscle, brain, uterus and esophagus.
  • Sequence similaritiesContains 2 actin-binding domains.
    Contains 4 CH (calponin-homology) domains.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human T Plastin protein images

  • 12.5% SDS-PAGE of ab116732 stained with Coomassie Blue.

References for Recombinant Human T Plastin protein (ab116732)

ab116732 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"