Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQES SKYLYMEYHSPDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVH SSSDGHIDPQHAAGKQLICLVQEPHSAPAVVAATPNYNPFFMNEQNRSAA TPPSQPPQQPSSMQTGMNPSAMQGPSPPPPPPSYMHIPRYSTNPITVTVS QNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSSGRQTPQSTPW QSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQC PSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAY LPYTASSLSKGSMKKIEITVEPSQRPGTAINRSPSPISNQPSPRNQHSLY TATTPPSSSPSRGISSQPKPPFSVNPVYITYTQPTGPSCTPSPSPRVIPN PTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIPGSGGEKGSHK YQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEELERLKSEVNGM EHDLMQRRLRRVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQS RGNFDPKAMNNFYDNIEPGPVVPPKPSKKDSSDPCTIERKARRISVTSKV QADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPAL NRCEQCEMPRYT
    • Amino acids
      1 to 712
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MAP3K7IP 3
    • Mitogen-activated protein kinase kinase kinase 7-interacting protein 3
    • NAP1
    • NF-kappa-B-activating protein 1
    • NFkB activating protein 1
    • TAB-3
    • Tab3
    • TAB3_HUMAN
    • TAK1 binding protein 3
    • TAK1-binding protein 3
    • TGF-beta-activated kinase 1 and MAP3K7-binding protein 3
    • TGF-beta-activated kinase 1-binding protein 3
    see all
  • Function
    Adapter linking MAP3K7/TAK1 and TRAF6 or TRAF2. Mediator of MAP3K7 activation, respectively in the IL1 and TNF signaling pathways. Plays a role in activation of NF-kappa-B and AP1 transcription factor. Isoform 2 may be an oncogenic factor.
  • Tissue specificity
    Widely expressed. Constitutively overexpressed in certain tumor tissues. Isoform 1 is a major transcript while isoform 2 is a minor transcript.
  • Sequence similarities
    Contains 1 CUE domain.
    Contains 1 RanBP2-type zinc finger.
  • Post-translational
    modifications
    Ubiquitinated; following IL1 stimulation or TRAF6 overexpression.
  • Information by UniProt

Images

  • ab166083 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up