Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09758
    • SpeciesHuman
    • SequenceHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLL KARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCW CVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAEL RRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYF ERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAG LIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
    • Molecular weight59 kDa including tags
    • Amino acids27 to 324

Specifications

Our Abpromise guarantee covers the use of ab114374 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cell surface glycoprotein Trop 2
    • Cell surface glycoprotein Trop-2
    • Cell surface glycoprotein Trop2
    • Epithelial glycoprotein 1
    • GA733 1
    • GA7331
    • M1S 1
    • M1S1
    • Membrane component chromosome 1 surface marker 1
    • Pancreatic carcinoma marker protein GA733 1
    • Pancreatic carcinoma marker protein GA733-1
    • Pancreatic carcinoma marker protein GA7331
    • TACD 2
    • TACD2_HUMAN
    • TACSTD 2
    • Tacstd2
    • Trop 2
    • Trop2
    • Tumor associated calcium signal transducer 2 precursor
    • Tumor-associated calcium signal transducer 2
    see all
  • FunctionMay function as a growth factor receptor.
  • Tissue specificityPlacenta, pancreatic carcinoma cell lines.
  • Involvement in diseaseDefects in TACSTD2 are the cause of gelatinous drop-like corneal dystrophy (GDLD) [MIM:204870]; also known as lattice corneal dystrophy type III. GDLD is an autosomal recessive disorder characterized by grayish corneal amyloid deposits that cause severe visual impairment.
  • Sequence similaritiesBelongs to the EPCAM family.
    Contains 1 thyroglobulin type-1 domain.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human TACD2 protein images

  • 12.5% SDS-PAGE with ab114374 at 58.78kDa stained with Coomassie Blue.

References for Recombinant Human TACD2 protein (ab114374)

ab114374 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114374.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"