Recombinant Human TADA3L protein (ab171703)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSELKDCPLQFHDFKSVDHLKVCPRYT AVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDK KGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQ PKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELL KPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMG PLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPM EDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGL LESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLRLAKEEVSR QELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESIL KLLDG
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 432
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.
    ab171703 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • ADA3
    • ADA3 homolog
    • ADA3-like protein
    • FLJ20221
    • FLJ21329
    • hADA3
    • Transcriptional adaptor 3 (NGG1 homolog yeast) like
    • Transcriptional adaptor 3 like
    see all
  • Relevance
    TADA3L functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. TADA3L is also known as a coactivator for p53/TP53-dependent transcriptional activation. The PCAF complex is composed of a number of TBP-associated factors (TAFS), such as TAF5, TAF5L, TAF6, TAF6L, TAF9, TAF10 and TAF12, PCAF, and also PCAF-associated factors (PAFs), such as TADA2L/ADA2, TADA3L/ADA3 and SPT3.
  • Cellular localization
    Nuclear

Images

  • 15% SDS-PAGE analysis of ab171703 (3µg).

References

ab171703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up