Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARH RKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALI RKTTKK
    • Amino acids
      56 to 161
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • TAF12
    • TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
    • TAF12_HUMAN
    • TAF15
    • TAF2J
    • TAFII 20/TAFII 15
    • TAFII-20/TAFII-15
    • TAFII20
    • TAFII20/TAFII15
    • Transcription initiation factor TFIID 20/15 kDa subunits
    • Transcription initiation factor TFIID subunit 12
    see all
  • Function
    TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the TAF12 family.
    Contains 1 histone-fold domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159633 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up