Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKY QSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLT QLEKDICTAK
    • Amino acids
      1532 to 1641
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC134910
    • TAF 1L
    • TAF(II)210
    • TAF1 like RNA polymerase II TATA box binding protein (TBP) associated factor 210kD
    • TAF1 like RNA polymerase II TATA box binding protein (TBP) associated factor 210kDa
    • TAF1 RNA polymerase II TATA box binding protein (TBP) associated factor 210kDa like
    • TAF1L
    • TAF1L_HUMAN
    • TAF2A2
    • TBP associated factor 1 like
    • TBP associated factor 210 kDa
    • TBP associated factor RNA polymerase 1 like
    • TBP-associated factor 1-like
    • TBP-associated factor 210 kDa
    • Transcription initiation factor TFIID 210 kDa subunit
    • Transcription initiation factor TFIID subunit 1 like
    • Transcription initiation factor TFIID subunit 1-like
    see all
  • Function
    May act as a functional substitute for TAF1/TAFII250 during male meiosis, when sex chromosomes are transcriptionally silenced.
  • Tissue specificity
    Testis specific, expressed apparently in germ cells.
  • Sequence similarities
    Belongs to the TAF1 family.
    Contains 2 bromo domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165421 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up