Overview

  • Product name
    Recombinant Human TAF2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYT SPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKK
    • Amino acids
      504 to 603
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 150 kDa cofactor of initiator function
    • 150kDa
    • 4732460C16Rik
    • AI425886
    • CIF150
    • Cofactor of initiator function, 150kD subunit
    • MGC166014
    • RNA polymerase II TBP associated factor subunit B
    • RNA polymerase II TBP associated factor subunit B 3
    • TAF(II)150
    • TAF2 RNA polymerase II, TATA box binding protein (TBP) associated factor
    • TAF2 RNA polymerase II, TATA box binding protein (TBP) associated factor, 150kDa
    • TAF2 RNA polymerase II, TATA box binding protein-associated factor, 150 KD
    • TAF2B
    • TAFII 150
    • TAFII150
    • TATA box binding protein (TBP) associated factor, RNA polymerase II, B, 150kD
    • TATA box binding protein associated factor 2B
    • TBP associated factor 150 kDa
    • TBP associated factor, RNA polymerase II, 150 KD
    • TBP-associated factor 2
    • Transcription initiation factor TFIID 150 kDa subunit
    • Transcription initiation factor TFIID subunit 2
    see all
  • Relevance
    Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF2 is one of the larger subunits of TFIID that is stably associated with the TFIID complex. It contributes to interactions at and downstream of the transcription initiation site, interactions that help determine transcription complex response to activators.
  • Cellular localization
    Nuclear

Images

  • ab159624 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159624 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up