Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNS SQFMKHTKRRKLTVEDFNRALRWSSVEAVCGYGSQEALPMRPAREGELYF PEDREVNL
    • Amino acids
      2 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CBP associated factor associated factor 65 kDa subunit 6L
    • PAF65 alpha
    • PAF65A
    • PCAF associated factor 65 alpha
    • TAF6 like RNA polymerase II p300/CBP associated factor associated factor 65 kDa subunit 6L
    • TAF6-like RNA polymerase II p300
    see all
  • Relevance
    TAF6L is a protein that is a component of the PCAF histone acetylase complex and structurally similar to one of the histone-like TAFs, TAF6. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation.
  • Cellular localization
    Nuclear

Images

  • ab161084 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161084 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161084.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up