Overview

  • Product name
    Recombinant Human TAF7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPD GRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVST VD GDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKR RFRK TAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAEN QGLDIS SPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEE DINIIDTE EDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKG KLQETQDRAK RQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSS LQEELESLLEK
    • Amino acids
      1 to 349

Specifications

Our Abpromise guarantee covers the use of ab91738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form
    Lyophilised
  • Additional notes
    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 76 µl aqua dest.

General Info

  • Alternative names
    • RNA polymerase II TBP-associated factor subunit F
    • TAF 7
    • TAF(II)55
    • TAF2F
    • TAF7
    • TAF7 RNA polymerase II
    • TAF7 RNA polymerase II TATA box binding protein (TBP) associated factor 55 kDa
    • TAF7_HUMAN
    • TAFII 55
    • TAFII-55
    • TAFII55
    • TATA box binding protein (TBP) associated factor RNA polymerase II F 55kD
    • TATA box binding protein associated factor 2F
    • TBP associated factor F
    • Transcription factor IID subunit TAFII55
    • Transcription initiation factor TFIID 55 kDa subunit
    • Transcription initiation factor TFIID subunit 7
    see all
  • Function
    Functions as a component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively).
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the TAF7 family.
  • Domain
    The [KR]-[STA]-K motif is specifically recognized by the SETD7 methyltransferase, which methylates Lys-5 in vitro.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab91738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab91738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up