Overview

  • Product name
    Recombinant Human TAFA 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRA APSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVT H
    • Molecular weight
      11 kDa
    • Amino acids
      31 to 131

Specifications

Our Abpromise guarantee covers the use of ab54415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    Purity : Greater than 98% by SDS-PAGE gel and HPLC analyses. Endotoxin Level : < 0.1 ng per µg (1EU/µg).
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • Chemokine like protein TAFA 2
    • Chemokine-like protein TAFA-2
    • Chemokine-like protein TAFA2
    • DKFZp761E1217
    • DKFZp781P0552
    • F19A2_HUMAN
    • FAM19A2
    • family with sequence similarity 19 (chemokine (C-C motif)-like), member A2
    • MGC42403
    • Protein FAM19A2
    • TAFA 2
    • TAFA2
    see all
  • Tissue specificity
    Brain-specific.
  • Sequence similarities
    Belongs to the FAM19/TAFA family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References for Recombinant Human TAFA 2 protein (ab54415)

ab54415 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab54415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up