Recombinant Human Tafazzin / TAZ protein (ab114664)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16635
    • SpeciesHuman
    • SequenceMPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYP CPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGD GVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPG DGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPR FGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQ AEQLHNHLQPGR
    • Molecular weight55 kDa including tags
    • Amino acids1 to 262

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114664 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein. Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Barth syndrome
    • Cardiomyopathy dilated 3A (X linked)
    • EFE2
    • Endocardial fibroelastosis 2
    • Protein G4.5
    • Tafazzin
    • TAZ
    • TAZ protein
    • TAZ_HUMAN
    see all
  • FunctionSome isoforms may be involved in cardiolipin (CL) metabolism.
  • Tissue specificityHigh levels in cardiac and skeletal muscle. Up to 10 isoforms can be present in different amounts in different tissues. Most isoforms are ubiquitous. Isoforms that lack the N-terminus are found in leukocytes and fibroblasts, but not in heart and skeletal muscle. Some forms appear restricted to cardiac and skeletal muscle or to leukocytes.
  • Involvement in diseaseBarth syndrome
  • Sequence similaritiesBelongs to the taffazin family.
  • DomainThe hydrophilic domain may serve as an exposed loop interacting with other proteins.
  • Cellular localizationCytoplasm and Membrane.
  • Information by UniProt

Recombinant Human Tafazzin / TAZ protein images

  • SDS-PAGE analysis of ab114664 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human Tafazzin / TAZ protein (ab114664)

ab114664 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114664.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"