Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSAR VSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTF
    • Molecular weight
      37 kDa including tags
    • Amino acids
      825 to 923

Specifications

Our Abpromise guarantee covers the use of ab152724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Axonal glycoprotein TAG 1
    • Axonal glycoprotein TAG-1
    • Axonal glycoprotein TAG1
    • Axonin 1
    • Axonin-1
    • Axonin1
    • AXT
    • CNTN 2
    • Cntn2
    • CNTN2_HUMAN
    • Contactin 2
    • contactin 2 (axonal)
    • Contactin-2
    • Contactin2
    • DKFZp781D102
    • MGC157722
    • TAG 1
    • TAG 564
    • TAG564
    • TAX
    • TAX 1
    • TAX-1
    • TAX1
    • Transient axonal glycoprotein 1
    • Transiently expressed axonal glycoprotein
    see all
  • Function
    May play a role in the initial growth and guidance of axons. May be involved in cell adhesion.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. Contactin family.
    Contains 4 fibronectin type-III domains.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane. Attached to the neuronal membrane by a GPI-anchor and is also released from neurons.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152724 stained with Coomassie Blue.

References

ab152724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up