Recombinant Human TAGLN3 protein (ab116179)

Overview

  • Product name
    Recombinant Human TAGLN3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMANRGPSYGLSREVQEKIEQKYDADLENKL VDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKI SESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLM ALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS NKGASQAGMTGYGMPRQIM
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 199
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab116179 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Neuronal protein 22
    • Neuronal protein NP25
    • NP22
    • NP25
    • TAGL3_HUMAN
    • TAGLN3
    • Transgelin 3
    • Transgelin-3
    see all
  • Tissue specificity
    Widely expressed in the brain. Expression is increased in the superior frontal cortex of alcoholics, but not in the motor cortex or cerebellum.
  • Sequence similarities
    Belongs to the calponin family.
    Contains 1 calponin-like repeat.
    Contains 1 CH (calponin-homology) domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab116179 (3µg)

References

ab116179 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up