Recombinant Human TAGLN3 protein (ab116179)

Overview

  • Product nameRecombinant Human TAGLN3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UI15
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMANRGPSYGLSREVQEKIEQKYDADLENKL VDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKI SESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLM ALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS NKGASQAGMTGYGMPRQIM
    • Molecular weight25 kDa including tags
    • Amino acids1 to 199
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab116179 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Neuronal protein 22
    • Neuronal protein NP25
    • NP22
    • NP25
    • TAGL3_HUMAN
    • TAGLN3
    • Transgelin 3
    • Transgelin-3
    see all
  • Tissue specificityWidely expressed in the brain. Expression is increased in the superior frontal cortex of alcoholics, but not in the motor cortex or cerebellum.
  • Sequence similaritiesBelongs to the calponin family.
    Contains 1 calponin-like repeat.
    Contains 1 CH (calponin-homology) domain.
  • Information by UniProt

Recombinant Human TAGLN3 protein images

  • 15% SDS-PAGE analysis of ab116179 (3µg)

References for Recombinant Human TAGLN3 protein (ab116179)

ab116179 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"