Recombinant Human TAGLN3 protein (ab116179)

Overview

  • Product name
    Recombinant Human TAGLN3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMANRGPSYGLSREVQEKIEQKYDADLENKL VDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKI SESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLM ALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS NKGASQAGMTGYGMPRQIM
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 199
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab116179 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Neuronal protein 22
    • Neuronal protein NP25
    • NP22
    • NP25
    • TAGL3_HUMAN
    • TAGLN3
    • Transgelin 3
    • Transgelin-3
    see all
  • Tissue specificity
    Widely expressed in the brain. Expression is increased in the superior frontal cortex of alcoholics, but not in the motor cortex or cerebellum.
  • Sequence similarities
    Belongs to the calponin family.
    Contains 1 calponin-like repeat.
    Contains 1 CH (calponin-homology) domain.
  • Information by UniProt

Recombinant Human TAGLN3 protein images

  • 15% SDS-PAGE analysis of ab116179 (3µg)

References for Recombinant Human TAGLN3 protein (ab116179)

ab116179 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up