Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVM VTNVTSL LKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKT STPEDFIRMTKGITMA TAKAVAAGNSCRQEDVIATANLSRRAIADMLR ACKEAAYHPEVAPDVRLRALHYGRE CANGYLELLDHVLLTLQKPSPEL KQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPE DPTVIAENELLGAA AAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAAT SALVK AASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVAAATNNLCEAA NA AVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAA GNAVKRASDNL VKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEE MLRKERELEEARKKLAQIRQ QQYKF (Amino acid sequence (Sequence determined by 5' Sequencing))
    • Amino acids2072 to 2532

Specifications

Our Abpromise guarantee covers the use of ab91740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 82 µl aqua dest.

General Info

  • Alternative names
    • ILWEQ
    • Talin
    • Talin 1
    • Talin-1
    • TLN
    • TLN 1
    • Tln1
    • TLN1_HUMAN
    see all
  • FunctionProbably involved in connections of major cytoskeletal structures to the plasma membrane. High molecular weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts.
  • Sequence similaritiesContains 1 FERM domain.
    Contains 1 I/LWEQ domain.
  • Cellular localizationCell projection, ruffle membrane. Cytoplasm, cytoskeleton. Cell surface. Cell junction, focal adhesion. Colocalizes with LAYN at the membrane ruffles. Localized preferentially in focal adhesions than fibrillar adhesions (By similarity).
  • Information by UniProt

Recombinant Human Talin 1 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human Talin 1 protein (ab91740)

ab91740 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"