Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSL QQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVIS GIAREKLPKVDIASAESSI
    • Molecular weight
      14 kDa
    • Amino acids
      1 to 119

Specifications

Our Abpromise guarantee covers the use of ab117667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab117667 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Additional notes
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.24% Tris

General Info

  • Alternative names
    • I TRAF
    • I-TRAF
    • ITRAF
    • Tank
    • TANK_HUMAN
    • TRAF family member associated NF KAPPA B activator
    • TRAF family member associated NFKB activator
    • TRAF family member-associated NF-kappa-B activator
    • TRAF interacting protein
    • TRAF interacting protein TANK isoform a
    • TRAF interacting protein TANK isoform b
    • TRAF-interacting protein
    • TRAF2
    see all
  • Function
    Acts as a regulator of TRAF function by maintaining them in a latent state. Overexpression inhibits TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May be involved in I-kappa-B-kinase (IKK) regulation; may function as an adapter for kinases such as TBK1 or IKBKE that can modulate IKK activity.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 C2H2-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated by IKBKE.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab117667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up