Recombinant Human Tankyrase 2 protein (ab164270)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAH SPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG
    • Amino acids
      1068 to 1166
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164270 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP-ribosyltransferase diphtheria toxin-like 6
    • ARTD6
    • PARP 5b
    • PARP 5c
    • PARP-5b
    • PARP-5c
    • PARP5B
    • PARP5C
    • pART6
    • Poly [ADP ribose] polymerase 5B
    • Poly [ADP-ribose] polymerase 5B
    • TANK2
    • Tankyrase 2
    • Tankyrase II
    • Tankyrase like protein
    • Tankyrase related protein
    • Tankyrase TRF1 interacting ankyrin related ADP ribose polymerase 2
    • Tankyrase-2
    • Tankyrase-like protein
    • Tankyrase-related protein
    • TNKL
    • TNKS 2
    • TNKS-2
    • TNKS2
    • TNKS2_HUMAN
    • TRF1 Interacting Ankyrin Related ADP ribose polymerase 2
    • TRF1-interacting ankyrin-related ADP-ribose polymerase 2
    see all
  • Function
    Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates poly-ADP-ribosylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates poly-ADP-ribosylation of TERF1, thereby contributing to the regulation of telomere length. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles.
  • Tissue specificity
    Highly expressed in placenta, skeletal muscle, liver, brain, kidney, heart, thymus, spinal cord, lung, peripheral blood leukocytes, pancreas, lymph nodes, spleen, prostate, testis, ovary, small intestine, colon, mammary gland, breast and breast carcinoma, and in common-type meningioma. Highly expressed in fetal liver, heart and brain.
  • Sequence similarities
    Contains 15 ANK repeats.
    Contains 1 PARP catalytic domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications
    Ubiquitinated at 'Lys-48' and 'Lys-63' by RNF146 when auto-poly-ADP-ribosylated; this leads to degradation.
    ADP-ribosylated (-auto). Poly-ADP-ribosylated protein is recognized by RNF146, followed by ubiquitination.
    The crystallographic evidence suggests that the 3-hydroxyhistidine may be the (3S) stereoisomer.
  • Cellular localization
    Cytoplasm. Golgi apparatus membrane. Nucleus. Chromosome > telomere. Associated with the Golgi and with juxtanuclear SLC2A4/GLUT4-vesicles. Also found around the pericentriolar matrix of mitotic centromeres. During interphase, a small fraction of TNKS2 is found in the nucleus, associated with TRF1.
  • Information by UniProt

Images

  • ab164270 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164270 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164270.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up