Recombinant Human Tankyrase protein (ab112380)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELK EIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDK EYQSVEEE
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1017 to 1124

Specifications

Our Abpromise guarantee covers the use of ab112380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    This product is useful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    ab112380 is best used within three months from the date of receipt.This product is useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • ADP-ribosyltransferase diphtheria toxin-like 5
    • OTTHUMP00000115550
    • OTTHUMP00000224675
    • PARP 5a
    • PARP5A
    • PARPL
    • pART5
    • Poly [ADP-ribose] polymerase 5A
    • TANK 1
    • TANK1
    • Tankyrase 1
    • Tankyrase I
    • Tankyrase TRF1 interacting ankyrin related ADP ribose polymerase
    • Tankyrase-1
    • Tankyrase1
    • TankyraseI
    • TIN 1
    • TIN1
    • TINF 1
    • TINF1
    • TNKS
    • TNKS 1
    • TNKS-1
    • TNKS1
    • TNKS1_HUMAN
    • TRF1 interacting ankyrin related ADP ribose polymerase
    • TRF1-interacting ankyrin-related ADP-ribose polymerase
    see all
  • Function
    May regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. Has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.
  • Tissue specificity
    Ubiquitous; highest levels in testis.
  • Sequence similarities
    Contains 15 ANK repeats.
    Contains 1 PARP catalytic domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications
    Phosphorylated on serine residues by MAPK kinases upon insulin stimulation.
    ADP-ribosylated (-auto).
  • Cellular localization
    Cytoplasm. Golgi apparatus membrane. Chromosome > centromere. Nucleus > nuclear pore complex. Chromosome > telomere. Associated with the Golgi and with juxtanuclear SLC2A4/GLUT4-vesicles. A minor proportion is also found at nuclear pore complexes and around the pericentriolar matrix of mitotic centromeres. During interphase, a small fraction of TNKS is found in the nucleus, associated with TERF1.
  • Information by UniProt

Images

  • ab112380 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab112380 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up