Recombinant Human Tankyrase protein (ab112380)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO95271
    • SpeciesHuman
    • SequenceTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELK EIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDK EYQSVEEE
    • Molecular weight38 kDa including tags
    • Amino acids1017 to 1124

Specifications

Our Abpromise guarantee covers the use of ab112380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThis product is useful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesab112380 is best used within three months from the date of receipt.This product is useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • ADP-ribosyltransferase diphtheria toxin-like 5
    • OTTHUMP00000115550
    • OTTHUMP00000224675
    • PARP 5a
    • PARP5A
    • PARPL
    • pART5
    • Poly [ADP-ribose] polymerase 5A
    • TANK 1
    • TANK1
    • Tankyrase 1
    • Tankyrase I
    • Tankyrase TRF1 interacting ankyrin related ADP ribose polymerase
    • Tankyrase-1
    • Tankyrase1
    • TankyraseI
    • TIN 1
    • TIN1
    • TINF 1
    • TINF1
    • TNKS
    • TNKS 1
    • TNKS-1
    • TNKS1
    • TNKS1_HUMAN
    • TRF1 interacting ankyrin related ADP ribose polymerase
    • TRF1-interacting ankyrin-related ADP-ribose polymerase
    see all
  • FunctionMay regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. Has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.
  • Tissue specificityUbiquitous; highest levels in testis.
  • Sequence similaritiesContains 15 ANK repeats.
    Contains 1 PARP catalytic domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications
    Phosphorylated on serine residues by MAPK kinases upon insulin stimulation.
    ADP-ribosylated (-auto).
  • Cellular localizationCytoplasm. Golgi apparatus membrane. Chromosome > centromere. Nucleus > nuclear pore complex. Chromosome > telomere. Associated with the Golgi and with juxtanuclear SLC2A4/GLUT4-vesicles. A minor proportion is also found at nuclear pore complexes and around the pericentriolar matrix of mitotic centromeres. During interphase, a small fraction of TNKS is found in the nucleus, associated with TERF1.
  • Information by UniProt

Recombinant Human Tankyrase protein images

  • ab112380 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Tankyrase protein (ab112380)

ab112380 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"