Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERS ERIKNLLERQEREIETFDMESLRMGFGNLVTLDFPKEDYR
    • Amino acids
      809 to 898
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CTCL tumor antigen HD CL 09
    • CTCL-associated antigen HD-CL-09
    • Cutaneous T cell lymphoma tumor antigen HD CL 09
    • Cutaneous T-cell lymphoma-associated antigen HD-CL-09
    • Dendritic cell derived protein kinase
    • Dendritic cell-derived protein kinase
    • DKFZp666H245
    • DPK
    • FLJ31808
    • hKFC A
    • hKFC-A
    • JIK
    • JNK/SAPK inhibitory kinase
    • JNK/SAPK-inhibitory kinase
    • Jun kinase inhibitory kinase
    • Jun kinase-inhibitory kinase
    • KDS
    • Kinase from chicken homolog A
    • MAP3K18
    • Serine kinase
    • Serine/threonine-protein kinase TAO3
    • STE20 like kinase
    • TAO kinase 3
    • TAOK3
    • TAOK3_HUMAN
    • Thousand and one amino acid protein 3
    see all
  • Function
    Inhibits the basal activity of Jun kinase. Negatively regulated by epidermal growth factor (EGF). When overexpressed, may activate ERK1/ERK2 and JNK/SAPK.
  • Tissue specificity
    Ubiquitously expressed at a low level, and highly expressed in peripheral blood leukocytes (PBLs), thymus, spleen, kidney, skeletal muscle, heart and liver.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Cell membrane. Also localized to the peripheral cell membrane.
  • Information by UniProt

Images

  • ab153349 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up