Recombinant Human Tapasin protein (ab114877)

Overview

  • Product name
    Recombinant Human Tapasin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEP WGPWTGNGTFWLPTVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSL MPAT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      197 to 300

Specifications

Our Abpromise guarantee covers the use of ab114877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NGS 17
    • NGS-17
    • NGS17
    • TAP associated protein
    • TAP binding protein
    • TAP binding protein (tapasin)
    • TAP BP
    • TAP-associated protein
    • TAP-binding protein
    • TAPA
    • Tapasin
    • TAPBP
    • TPN
    • TPSN
    • TPSN_HUMAN
    see all
  • Function
    Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading).
  • Tissue specificity
    Neutrophils, mostly in fully differentiated cells.
  • Sequence similarities
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Domain
    The N-terminus is required for efficient association with MHC class I molecule and for a stable interaction between MHC I and calreticulin. Binding to TAP is mediated by the C-terminus region.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114877 at approximately 37.07kDa.
    Stained with Coomassie Blue.

References

ab114877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up