Recombinant Human Tapasin protein (ab114877)

Overview

  • Product name
    Recombinant Human Tapasin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEP WGPWTGNGTFWLPTVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSL MPAT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      197 to 300

Specifications

Our Abpromise guarantee covers the use of ab114877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NGS 17
    • NGS-17
    • NGS17
    • TAP associated protein
    • TAP binding protein
    • TAP binding protein (tapasin)
    • TAP BP
    • TAP-associated protein
    • TAP-binding protein
    • TAPA
    • Tapasin
    • TAPBP
    • TPN
    • TPSN
    • TPSN_HUMAN
    see all
  • Function
    Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading).
  • Tissue specificity
    Neutrophils, mostly in fully differentiated cells.
  • Sequence similarities
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Domain
    The N-terminus is required for efficient association with MHC class I molecule and for a stable interaction between MHC I and calreticulin. Binding to TAP is mediated by the C-terminus region.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human Tapasin protein images

  • 12.5% SDS-PAGE showing ab114877 at approximately 37.07kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Tapasin protein (ab114877)

ab114877 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up