Recombinant Human Tapasin Related Protein (ab153392)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASLVLKQVPVLDD GSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVT
    • Amino acids
      23 to 121
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ10143
    • TAP binding protein like
    • TAP binding protein related
    • TAP binding protein related protein
    • TAP-binding protein-like
    • TAP-binding protein-related protein
    • Tapasin like
    • Tapasin R
    • Tapasin-like
    • TAPASIN-R
    • Tapasin-related protein
    • TAPBP L
    • TAPBP R
    • TAPBP-R
    • Tapbpl
    • TAPBPR
    • TPSNR_HUMAN
    see all
  • Sequence similarities
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Microsome membrane. Mainly found in endoplasmic reticulum but a minority is found on the cell surface.
  • Information by UniProt

Images

  • ab153392 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up