Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPW PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT TPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQ AVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFS SLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTT VYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGI SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGA YIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFE VEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALT GLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLST RPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKD AIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERM IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADI DLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT ISETIERLQQLKEFRSKQAEEEF
    • Molecular weight
      83 kDa
    • Amino acids
      1 to 723
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.2
    Constituents: 20% Glycerol, 1.17% Sodium chloride, 78% PBS

General Info

  • Alternative names
    • cytoplasmic
    • MGC9344
    • SYTC_HUMAN
    • TARS
    • Threonine tRNA ligase 1
    • Threonine tRNA ligase 1, cytoplasmic
    • Threonine--tRNA ligase
    • Threonyl tRNA synthetase
    • Threonyl tRNA synthetase, cytoplasmic
    • Threonyl-tRNA synthetase
    • ThrRS
    see all
  • Sequence similarities
    Belongs to the class-II aminoacyl-tRNA synthetase family.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of 2.5 µg ab185593.

References

ab185593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up