Recombinant Human Tartrate Resistant Acid Phosphatase protein (ab114490)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP13686
    • SpeciesHuman
    • SequenceVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRH QRKVPNGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLP RRARP
    • Molecular weight37 kDa including tags
    • Amino acids221 to 325

Specifications

Our Abpromise guarantee covers the use of ab114490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Type 5 acid phosphatase
    • Acid phosphatase 5 tartrate resistant
    • Acid phosphatase 5, tartrate resistant
    • ACP5
    • EC 3.1.3.2
    • MGC117378
    • PPA5_HUMAN
    • serum band 5 tartrate-resistant acid phosphatase
    • SPENCDI
    • T5ap
    • Tartrate resistant acid ATPase
    • Tartrate resistant acid phosphatase type 5
    • Tartrate resistant acid phosphatase type 5 precursor
    • Tartrate-resistant acid ATPase
    • Tartrate-resistant acid phosphatase type 5
    • TR AP
    • TR-AP
    • TRACP 5
    • TRAP
    • TrATPase
    • Type 5 acid phosphatase
    see all
  • FunctionInvolved in osteopontin/bone sialoprotein dephosphorylation. Its expression seems to increase in certain pathological states such as Gaucher and Hodgkin diseases, the hairy cell, the B-cell, and the T-cell leukemias.
  • Sequence similaritiesBelongs to the metallophosphoesterase superfamily. Purple acid phosphatase family.
  • Cellular localizationLysosome.
  • Information by UniProt

Recombinant Human Tartrate Resistant Acid Phosphatase protein images

  • 12.5% SDS-PAGE showing ab114490 at approximately 37.18kDa stained with Coomassie Blue.

References for Recombinant Human Tartrate Resistant Acid Phosphatase protein (ab114490)

ab114490 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"